DPCstruct | MC4254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 538 ± 91 aa |
| Standard deviation of domain lengths | 90.71 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496PSU1 | 189-691 | QSMGALLALNGMVALVFDPLDQSERMQYRNEDGVGLFHGTHMHMQEGVAAILLGEGLIRTFIWDGTRALDYLESRPEVDPERLAVTG… |
| A0A3N5PKQ4 | 173-656 | ERYDLWSIGPMGIQLWDSIRATDFVSSLPDVDSQRIVATGASGGGTQTFFLMAVDERIKAAAPVNMISATSQGGVCENAPNLRAGWT… |
| A0A7G8UTW4 | 543-1058 | None |
| A0A5B9MGK1 | 168-674 | None |
| A0A7X7LCX2 | 672-1174 | None |
| A0A2E9VIV2 | 179-665 | None |
| A0A1N6HSN3 | 12-704 | None |
| A0A5B9Q8F1 | 320-903 | None |
| A0A7X3R7M7 | 1-432 | None |
| A0A831T9D3 | 3-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.