DPCstruct | MC42534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 192 ± 31 aa |
| Standard deviation of domain lengths | 30.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20232 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5L5K6 | 16-199 | AFLRGAGLPAEAIGTLTPELMELLGKMMNNCIQGTIDLLALRSLVKQEVKADVTVVVLRNNNPMKFFPDSQTVLTQMLRKKMPGFME… |
| A0A3P5XVY8 | 3-165 | RLGRALRSMITGLREVLMTRASIKQEFRIGQTVIASGGNNPLKFSVSPEQAVEAMVRPGGPGWLPPDAAADQALQDLKAHEVAMLTG… |
| A0A251WN29 | 14-162 | None |
| A0A7G6AER5 | 45-234 | None |
| A0A509EMP8 | 2-145 | None |
| A0A150P440 | 5-165 | None |
| A0A376ZMA5 | 69-249 | None |
| A0A1B8T7W8 | 13-210 | None |
| A0A7W2BY60 | 108-335 | None |
| A0A3M4Q256 | 15-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.