DPCstruct | MC42533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 346 ± 81 aa |
| Standard deviation of domain lengths | 81.17 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.36 |
| Pfam Score | 56.19 |
| Assigned Pfam label(s) | CL0223- PF08495- PF10442- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5MHU9 | 392-775 | KTKVGYSENVDAYTSGVETAKMANKIENPQVGLLFTSCVQDQKEIMKGVKSVLKDIDIVGCTSSAAICTQDGYLNKPTGYSGMMLLG… |
| A0A496YMI3 | 36-415 | IRKHPPSAVLAFASVCYELDELLAGVNEVVGDAPVLGATTAGEIMDGPHEKSVVVAILASPFLAVRIGIGRDASKGWNRAVAEAVGC… |
| A0A099P4T2 | 60-354 | None |
| A0A6J7UZ23 | 141-521 | None |
| A0A504WXM9 | 640-970 | None |
| A0A6G0XRV4 | 319-673 | None |
| A0A1Y2H4Y5 | 54-398 | None |
| A0A357NC67 | 15-239 | None |
| A0A1V9Y5K3 | 413-821 | None |
| A0A7S2MI60 | 21-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.