DPCstruct | MC4253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.63 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2DH42 | 374-449 | SAPITGKYWAEGPTAIEINGKWVVYFDKYIDKKYGAVTSGDLKQWEDISDRIRFPEGTRHGTVFKVPRDLFLKLNN |
| A0A359M1M0 | 10-80 | IEGPSVLRMGAEWWIYYDSYRKPQHYGAIRTRDWKTFEDVTKEVRFPADHRHGTVVTITEEAADRLRSAAP |
| A0A7Y2DEH6 | 96-171 | None |
| A0A060BVJ9 | 3-70 | None |
| A6DM37 | 1-69 | None |
| A0A350UHA6 | 413-491 | None |
| A0A3M1I909 | 165-239 | None |
| A0A7Y4UGY3 | 235-307 | None |
| A0A520HTK8 | 15-88 | None |
| A0A5J4S9Y6 | 55-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.