DPCstruct | MC4252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 7.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A223Q997 | 3-80 | VQAHLAGHFSPLTGDYRWRGRLSPSPEVTAAFRAGARTVVVRTPDGFEGTGVLDEPNLWGGHPVNGAGSPPFAVPHVD |
| A0A849ADR5 | 187-277 | DAAWYGPAEIELPDGERITVQAQLTGAMQPTDGQYHWQGHIAAADGLKPGTKIVVHAGGTPAPGRVSELTPWGSLHITGAGQPPFPL… |
| A0A5Q6S4B6 | 87-182 | None |
| A0A0Q8WMU3 | 2-78 | None |
| A0A7U1EF07 | 69-177 | None |
| A0A7C3U9E7 | 1-96 | None |
| A0A6G6WUX3 | 42-126 | None |
| G7H1Z7 | 128-220 | None |
| A0A7K3GCA7 | 2-94 | None |
| A0A7L7M6C8 | 2-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.