DPCstruct | MC42518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 237 ± 44 aa |
| Standard deviation of domain lengths | 44.22 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 13.78 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF11178- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5JTU5 | 1-249 | MINLFENYNQDSWDLHYSLILSGYQNTTIAINDNGFLPDDVTSPFLFFTGFVNATGKPLHFNEIPVPKFWEIKATNSSGEIFDLNKK… |
| K1A3I9 | 2-195 | GFADDQVIWLYNHFTDIKLAPTSVTVDEVLASFGGLESHREQDGKILRVYFSDEDKFVTCYLVDSAKNLVQHAEYVFGGNLIRKDYF… |
| A0A837EH02 | 33-262 | None |
| A0A6A0BFE6 | 1-271 | None |
| I2JB35 | 2-263 | None |
| A0A6L2ZRY7 | 1-290 | None |
| A0A0D0Y338 | 4-212 | None |
| A0A559KIY0 | 88-239 | None |
| A0A0A6S4D6 | 2-203 | None |
| A6GMC9 | 545-801 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.