DPCstruct | MC42513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 620 ± 116 aa |
| Standard deviation of domain lengths | 115.95 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 16.20 |
| Pfam Score | 47.47 |
| Assigned Pfam label(s) | PF04114- CL0105- CL0046- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G9FG84 | 31-571 | LCRETASFLSSFGFKAQSAPLVSGGQNDFPYNVYTRISASEKSAEPNERTSLILAFTMEDAYARRDFFAPFLRRLKELKSDSDIILL… |
| A0A0K8VL24 | 8-736 | VSNVVVKLAPKNVKSASYLLVNAHFDSEVHSPAAADDGVMVVIMLETLRVIAKSEKPLMHPIVFLFNGAEESNLLASHGFITQHPWA… |
| A0A177WZB7 | 12-551 | None |
| A0A7R8X158 | 55-855 | None |
| A0A066WPV8 | 128-733 | None |
| K8EZV1 | 1-517 | None |
| A0A507E6Q0 | 97-622 | None |
| A0A7X7BKU1 | 39-560 | None |
| A0A2P8XVS1 | 81-666 | None |
| A0A2I0RZ64 | 2-668 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.