DPCstruct | MC42511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 259 ± 22 aa |
| Standard deviation of domain lengths | 22.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.51 |
| Pfam Score | 65.56 |
| Assigned Pfam label(s) | CL0760- PF09333- CL0266- PF16909 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3N7J5 | 23-278 | IEGAPIKINALELRDVVGTLNDVVYILKDRYMIRLKRNLFSILGASSLIGNPIQLVNNVSSGVKDFFYKPIEGFVEGPIEGGKGLVK… |
| A0A498LET3 | 540-748 | FERGPICTTPRQLVHTLAMHYAAGALFRAGWVVGSLEILGSPASLVRSIGNGVSDFFRLPYEGLTRGPGAFISGVSRGTNSFIKHIS… |
| A0A7C9EY63 | 125-398 | None |
| A0A3P7ZGW0 | 129-368 | None |
| A0A835L1C5 | 562-843 | None |
| A0A820XC37 | 166-442 | None |
| A0A7S4NJ89 | 173-414 | None |
| A0A0A0LY06 | 2-256 | None |
| A0A446JYC2 | 452-680 | None |
| A0A7R9UE31 | 765-1054 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.