DPCstruct | MC42505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 136 ± 11 aa |
| Standard deviation of domain lengths | 11.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4ZLW7 | 12-148 | SQFSTFNTQELIPYAPHYLAGWRAEAYAVELMPAWGMGQQKMAQVQQGRCSGDVGGDTHRSLMVQNNFTRVTFKHVLLPIWIAAYRY… |
| A0A329KR01 | 194-341 | ASEKMSDKLMDRLEPFPYHQLKSFKTPYLAGYRADKYSYTGEELLPRVKEKIRPYVEAYIQSAMAGYTTVSYTQKDIDTRMTQADYV… |
| A0A2R6AXA6 | 1-126 | None |
| W4V5B5 | 2-138 | None |
| A0A7C6ZZJ4 | 21-151 | None |
| A0A800JEF7 | 90-222 | None |
| A0A1V5PJU8 | 50-195 | None |
| F5UFX3 | 85-217 | None |
| A0A0W8F2W9 | 87-216 | None |
| A0A401R431 | 743-884 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.