DPCstruct | MC42503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 131 ± 13 aa |
| Standard deviation of domain lengths | 13.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5NBS1 | 46-176 | GGPKEDLTSVCGYDAEVGPDGPGWLALDEEEQMARVAKYHERIQKPGEEPPNVQRHVGMHVLVEQQIARNQPPEAAQALARLRRDGM… |
| Q2IF89 | 1-122 | MDYDADHAPDPSAWLAADEAERLRAVEAHHAGLTSHARMPKPRLHAALHLVVEAQLASGEPPEARRALERLLRGGLPRHEAVHAIGL… |
| A0A1V0KNE1 | 18-161 | None |
| A0A1J5QMB9 | 193-326 | None |
| A0A0R3E1C9 | 33-188 | None |
| A0A661V5E3 | 124-273 | None |
| A0A7X9ISP9 | 16-149 | None |
| A0A497VQJ7 | 3-127 | None |
| A0A7V5LJF6 | 4-134 | None |
| A0A4R8JFD1 | 122-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.