DPCstruct | MC42501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 211 ± 35 aa |
| Standard deviation of domain lengths | 35.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5J303 | 56-273 | IIGLVVVANMFRSKSKGGAKGGMQASSYSGPDGMYVSRLSLGIDWRARPELQATLMRLAQSGDTTSPQGLANLLRETALALRRAELS… |
| A0A7Y6UJI3 | 6-201 | DYTPPDLVDVTVLRIAIDARARKFVQTELARIAATADTKTSFGRLQMLREVSIMLRKLRDAWVYGGAINEPMRDLQGAKIAFDQHVD… |
| A0A1E5W972 | 427-633 | None |
| A0A1Y1HUM6 | 559-799 | None |
| A0A3L6TR26 | 158-400 | None |
| A0A200Q4U9 | 71-311 | None |
| A0A2K3P2R5 | 100-362 | None |
| A0A0D3GVU2 | 162-369 | None |
| A0A1R3JNY2 | 78-319 | None |
| A0A068UJ25 | 15-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.