DPCstruct | MC4250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 194 ± 20 aa |
| Standard deviation of domain lengths | 19.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 65.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.79 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0020- PF08492 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q95SX0 | 2-208 | WRQAAEFHLRGGASETAASSLEELLKLNPNDTKVLAQLVIAYAQFQPKRALELSRKLPKLETLTTASEIDALEAANWVMSAKAAKKT… |
| A0A7S3WMQ9 | 18-204 | QALLRAAAAFYARHGRWEAAAAAHRRLLAKSPRDAATLAALVVAESHFDSEQAHESLARLEMMCPPLDDEPDASIDAEALEQAALPK… |
| B0BND9 | 36-222 | None |
| A0A8B6BIF3 | 5-226 | None |
| A0A812NQU8 | 656-814 | None |
| H0EWX2 | 265-443 | None |
| A0A1B9FSJ1 | 121-309 | None |
| A0A813APZ1 | 256-447 | None |
| A0A430Q2F0 | 158-390 | None |
| I1K3J0 | 458-662 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.