DPCstruct | MC42492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Standard deviation of domain lengths | 6.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 46.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00285 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521SIY0 | 42-102 | YDPGFTSTASCQSALTYIDGDEGILLHRGYPIDQLAEQSSFMEVSYLLLNGELPSGKELAD |
| A0A2G2YTJ8 | 28-76 | LYDPGYLNTAPVRSSICYIDGDAGILRYRGYPIEELADESSFLEVAYLL |
| A0A1Q7HWJ6 | 60-126 | None |
| A0A021X413 | 43-103 | None |
| A0A378F8Z4 | 10-66 | None |
| A0A377Z4Y9 | 41-86 | None |
| U6KSW7 | 61-117 | None |
| A0A1V1P5B9 | 39-95 | None |
| A0A7J6U1L1 | 71-127 | None |
| A0A376RNJ6 | 8-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.