DPCstruct | MC4249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 220 ± 43 aa |
| Standard deviation of domain lengths | 43.37 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.46 |
| Pfam Score | 65.08 |
| Assigned Pfam label(s) | PF00122- PF00690- PF12409 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7WN14 | 2-175 | PLDSLVDTVTTYRQRPLWAHVYAGPFLVIYTIWFYVWYSIYGFDDYYELGCIGMGVIGILQALVILFGHWFVGVKCALSCVYEKDPN… |
| Q8T0G2 | 3-224 | PHNDSKDSKPCIGLLNPDQEDQMKVCGYRRSLMRTGFCWACIFLTGGLLRLVLHWWRHLYLYATCSQCSLEEAEQVLVTEDYQGKHK… |
| A0A5J4VQS7 | 3-237 | None |
| A0A7J6UDJ2 | 63-384 | None |
| A0A7J6L294 | 173-452 | None |
| K3W617 | 23-227 | None |
| A0A1S8VTL8 | 127-396 | None |
| A0A1Y1NM94 | 7-159 | None |
| A0A812MW82 | 2-285 | None |
| A0A3Q0J4D2 | 2-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.