DPCstruct | MC42484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 320 |
|---|---|
| Mean domain length (aa) | 102 ± 29 aa |
| Standard deviation of domain lengths | 28.65 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 83.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0337 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1MCW1 | 3-106 | KIILPDSDEELLTLCRIDTFRSSGAGGQHVNTTDSAVRLVFLPCNITVTCQQERSQFQNKMLCIKKLREKIEKLNYRKPKRIPTKIS… |
| A0A4X1V1U9 | 322-457 | SDEKCEKHFPIEIDTADYVSAGPSIRNPKARVVTLRVKLSSLNLDDHAKKKLIKLVGDRYCKSTDVLTIKTDRCPLKRQNYDYAVYL… |
| A0A6G3V2G2 | 1-86 | None |
| A0A6I9YKQ9 | 86-170 | None |
| A0A4S2N4G6 | 48-153 | None |
| A0A6G0XP61 | 31-124 | None |
| A0A2H6KJB1 | 5-104 | None |
| A0A2H6K9M3 | 103-226 | None |
| A0A2H6K9G7 | 221-302 | None |
| A0A7W7J525 | 113-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.