DPCstruct | MC42482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 86 ± 14 aa |
| Standard deviation of domain lengths | 13.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1HGZ1 | 19-108 | STSPDFEILCLPISLKTQMTEMGTWKPECPVDIDRLRLVKFIHYDFSGDQKHGEIVVLEAIAARVVNIFQALHGHQFPIAQAKTMEH… |
| A0A1G0MEJ5 | 12-87 | MAVPVPKSVELEMRLKKSWREGCPVPISDLSYLVLGYWDFDGKPQIGELVVHRKLALAMVTAFGELYALRFSIDRM |
| A0A4R6KDX2 | 258-373 | None |
| A0A4P7U9U4 | 185-266 | None |
| A0A261DBI5 | 21-90 | None |
| A0A482ZYU1 | 219-309 | None |
| A0A483AAS5 | 109-210 | None |
| A0A839QHI9 | 3-81 | None |
| A0A4R7J9R0 | 376-445 | None |
| A0A0A8UW99 | 3-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.