DPCstruct | MC4248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.26 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14913 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2T534 | 4-81 | QGGKSTSFVSGTKKSVHTTFKDGSELVEEYDLKTDELLVRKKRSKTKLGGEGKWEYLVGDAPVHFNAEGSTIMESSSN |
| A0A834A588 | 3-85 | VTGWLESLRDAEKTALLQDGRRKVHYLFPDGKEMAEEYDEKTKELLVRKWRVKSALGALGQWQIEVGEPAPHGAGNLGPELIK |
| A0A8B6DLR5 | 1-92 | None |
| A0A6P3Y6L1 | 2-87 | None |
| A0A813SQC0 | 9-95 | None |
| A0A821XX78 | 42-123 | None |
| A0A2B4SD72 | 502-586 | None |
| A0A2P8Z2E7 | 1-85 | None |
| A0A7J5Y4N2 | 31-112 | None |
| L5MBI4 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.