DPCstruct | MC42479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 211 ± 35 aa |
| Standard deviation of domain lengths | 34.66 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5KST0 | 15-185 | YSEAEKQAITQEFLNWAIPRAQIGNMTVTSQYFAHGAGGRGDWYGVTVDGRIQVQELMTPGYNAFELHSLGGVVFYTSLDGSTGLNE… |
| A0A4R6BJ29 | 1-145 | MAVTKMWFTYGAAGREDWYAETPYGEVQVQDNEYPGFSDFQNHEIADVVFYTAAEGLTDKYEPEGITAEGYARVAKGGTGIHKYMLG… |
| A0A6G7ENH5 | 28-265 | None |
| A0A327ZY68 | 213-380 | None |
| K9AWC5 | 7-223 | None |
| K8Z9C9 | 21-236 | None |
| A0A3N5CDM7 | 276-446 | None |
| A0A430ALK8 | 82-303 | None |
| A0A6N9I3M5 | 54-312 | None |
| A0A139NJD0 | 240-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.