DPCstruct | MC42472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1041 |
|---|---|
| Mean domain length (aa) | 248 ± 67 aa |
| Standard deviation of domain lengths | 67.30 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.91 |
| Pfam Score | 59.97 |
| Assigned Pfam label(s) | CL0023- PF01131- CL0063- CL0324- CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662QH30 | 45-286 | KVLTERGWIRVSDLRKGDRLFIQPSGCFGKYGSTELGRILGWLVGDGQIDDDGRVTLWFYGKDKELATIIAEDVKKILGRSVRINEA… |
| H5SRB9 | 14-208 | QKLALTDLQREILVGLLLGDACLETQNRGRTYRLKIEHSVAQAQYVQHLYHIFRDWVLQEPQIKRQRIAGKTYQKLWFNTVSHGAFR… |
| A0A2D6PI25 | 53-285 | None |
| A0A2D6NYV4 | 113-334 | None |
| A0A2D6NYR2 | 106-315 | None |
| E6N3C0 | 193-403 | None |
| A0A2D6NXM6 | 110-411 | None |
| A0A0F9UEH8 | 32-371 | None |
| A0A1Q7DKI5 | 15-197 | None |
| A0A2D6G7Q2 | 24-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.