DPCstruct | MC42471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 148 ± 23 aa |
| Standard deviation of domain lengths | 22.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.26 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | PF03925- CL0263- CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662Q3D8 | 41-172 | KIVPEQLVKPSLPKSGVTLTELLERLKKGEIFSRPPRKIHLPNGETETINLWKDILIAIAKHYSKHLRDKLPIKPPYGKRTLMNKTA… |
| A0A7X0ASP0 | 7-123 | KELNGLTFDKHIYPREFRDEENVVPVSSWVELSIAFLRWLLENGHLCMHKVPVANHAGRGKYLINSEKRHEYPDLDANWERVGAYYI… |
| A0A3A9H2D0 | 63-230 | None |
| A0A5F0TL91 | 44-204 | None |
| A0A832DJ27 | 42-227 | None |
| A0A840HZS1 | 39-161 | None |
| A0A7T2GL95 | 14-175 | None |
| A0A7V3HNJ1 | 158-261 | None |
| A0A850TBL7 | 38-235 | None |
| A0A7V6QNK5 | 416-585 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.