DPCstruct | MC42470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 138 ± 28 aa |
| Standard deviation of domain lengths | 27.70 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662PNJ2 | 50-175 | NNSVIEYFAPDVKKRVQEILDTLRFDHVDPERLHCVRSRGSKAKNTIARIHGLGRIWQETLGMEPTYILEVIHEQFDYYPREAQDRT… |
| A0A832ZNB5 | 4-122 | QYRVCSGVYEAVKHIVSLLGFKHIYTERVRVVCSQGSRSTATARIWGLPKPFAIAYGVPPCYVIEVLDERFWNLSCEERVAVLVHEL… |
| A0A832XFQ4 | 5-108 | None |
| A0A7C7VAW6 | 12-205 | None |
| A0A6G8FWF7 | 4-138 | None |
| A0A1V5FK77 | 2-190 | None |
| A0A842UZX4 | 142-244 | None |
| A0A2H9LWE0 | 18-134 | None |
| U5QHK5 | 18-162 | None |
| A5MYP8 | 47-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.