DPCstruct | MC4247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 83 ± 2 aa |
| Standard deviation of domain lengths | 2.43 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 40.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6Z221 | 129-207 | KDMGPGQKVVAVQSEVFGVTDEECQSALRLNSWDVLKTINYLKIEQLFRIGVSSRERCQQILQAAAWDLQSASRFLLLE |
| A0A7N5ZX01 | 659-741 | MDSSQSSAPVQGSVHGVTLEECRAALETHNWSIPQAIKHLKVEQLFRLGLRSRAECEELLQSCQWKLEQASTVMLDTYGPHQN |
| A0A455B114 | 649-737 | None |
| A0A7R8CIE1 | 817-899 | None |
| A0A6I9Z450 | 72-154 | None |
| A0A834AWZ3 | 358-441 | None |
| A0A212D723 | 40-120 | None |
| A0A6I9NMU3 | 1-82 | None |
| A0A3L7GMC7 | 310-391 | None |
| A0A7J8D324 | 347-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.