DPCstruct | MC42462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 149 ± 10 aa |
| Standard deviation of domain lengths | 10.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A557QFG8 | 1-142 | MPRIVSPSAAESFLFAAQGLFDGAEALEAPSSRQPLACAFLSAQALECTLKAFLSHSGMDQRQLKSIGHNLEKLWTQAASAGLVVSE… |
| A0A154R1S6 | 2-134 | LRYAEYYRIAAEQVIGDCNPLESRLLMLAYNLIAQSIELSLKAYLLSKGLKNSRLRGPLLGHNLSGLIAEAESLGLNNLVSLDDLDR… |
| A0A7X6FH26 | 228-374 | None |
| A0A3A5JSM9 | 11-169 | None |
| A0A7V2GYU8 | 17-168 | None |
| A0A418KZV2 | 7-169 | None |
| A0A546YVU4 | 141-284 | None |
| A3TTL7 | 1-160 | None |
| A0A7Y4LWG0 | 2-152 | None |
| H0SJE3 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.