DPCstruct | MC42460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 257 ± 26 aa |
| Standard deviation of domain lengths | 25.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J7SFG3 | 21-273 | VSDDRIHELLLLTDPTAAVTGLVDAALEAGAPDNVTCVVADVVAADEAREGDRPVVVGAAGEARNRDRLPTLLFPADRQPDTRAATV… |
| A0A847A5M1 | 37-275 | VLDTKPGDLWLLCSDGLCGYVEDDDVERILLRRHSLQGAVDGLIDKALSFGAPDNVTVVLVETQPGPASNTEPGDPRFAGSAATQPD… |
| A0A7Y3LFD7 | 47-350 | None |
| A0A6J6XVX2 | 1-258 | None |
| A0A6L5G0W8 | 1-197 | None |
| A0A7V9KZL0 | 84-317 | None |
| A0A7J5A5W9 | 11-239 | None |
| A0A651GR11 | 154-417 | None |
| A0A4D4L7U4 | 2-283 | None |
| A0A847H8M4 | 1-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.