DPCstruct | MC4246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 123 ± 17 aa |
| Standard deviation of domain lengths | 17.38 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q6IL17 | 1-122 | MLLLTNFNGTLRTAAENYDLIGSFIIQFDNETIMVNGQNYSSYSVSHLMAMPAVLSHITASNFQLSLEYVHDVSMKNLEKMSNMASE… |
| A0A7R8UD92 | 191-313 | LFNDFKGKVEINGTEQDLRGTYLIKFKNITITVNNQSYRSLETTNIQLLPPLLHVGIEKDELVEILSMELIKEMHINNTRQIKLLEA… |
| A0A1A9WPF4 | 29-174 | None |
| A0A811VJB2 | 195-316 | None |
| A0A1B0BKR6 | 87-208 | None |
| A0A1A9V8F0 | 109-196 | None |
| A0A6P8JFI2 | 8-138 | None |
| A0A811UTW4 | 48-195 | None |
| B4NV57 | 37-152 | None |
| A0A7R8YVW4 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.