DPCstruct | MC42458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 151 ± 13 aa |
| Standard deviation of domain lengths | 12.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19877 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J7RMU3 | 1-163 | MWAVSYCLGAGVSVGGGVSLSPFIAVSTPVELPPFPLLAALPQDVGLVAWALPAIGVVAGALIAISVARGIFPLGRRVALSVGASFI… |
| A0A0T6LL89 | 393-542 | VWAACYALTPGFAVGTDTVVAPAGARYSELPRFPLFAALPGQGDGGTAGWLTLMVPITAAVVVVAVVARGMRALPPARCGVPGAAAV… |
| A0A847IZ90 | 3-131 | None |
| A0A329XGM0 | 61-215 | None |
| A0A345SW50 | 303-453 | None |
| A0A2H1JK31 | 247-387 | None |
| A0A1Q9VU49 | 10-147 | None |
| A0A0K2QZ64 | 3-159 | None |
| A0A6J6ACV8 | 43-174 | None |
| A0A7W0GIW1 | 57-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.