DPCstruct | MC42451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 192 ± 22 aa |
| Standard deviation of domain lengths | 21.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.48 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF00784- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A671XYB9 | 74-224 | YWSITVYGRKHCYRLYTKHFNEAVHWACAIQKIIDTKAPVETPTQLLIRDIEENKFHPEVVEHIYQHNPILKYTQGPLYAPLLPFPY… |
| A0A835CP92 | 1-183 | MRDARVEEVESDSDSEERDTECPHVRTIGILPTHQGSTYLLKPHKQDKDSWLYHLTVVSGGGPSEGTQYEQLVQRLMETNGDPGCVL… |
| A0A1Y3EDL1 | 367-552 | None |
| F6NJM7 | 778-961 | None |
| B3SDC8 | 19-213 | None |
| A0A183V862 | 197-390 | None |
| A0A2D0T258 | 39-245 | None |
| A0A182UIR9 | 160-373 | None |
| A0A5E4QKN0 | 423-592 | None |
| A0A7R8ZLC3 | 25-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.