DPCstruct | MC42450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 156 ± 21 aa |
| Standard deviation of domain lengths | 20.76 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 40.26 |
| Pfam Score | 84.36 |
| Assigned Pfam label(s) | CL0229- PF02207 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835CN67 | 25-178 | QPNRRSNTIDQGYIRQALYACKTSCFGDDEKQAGVCLACSFRRHKGHEFIDLYTKRSFRCDCGDSNFGNKKCILDKAKARLNIENKH… |
| A0A2N9J358 | 21-164 | GVEEQELEADLVLGGDEGKECTYTNGYMKRQAIFSCLTCTPDGNAGVCTACSLSCHDGHEIVELWTKRNFRCDCGNSKFGEFFCKLF… |
| A0A0F8V161 | 14-200 | None |
| A0A3N4IEN3 | 32-207 | None |
| A0A109FKP9 | 26-157 | None |
| A0A2A2KLM3 | 401-561 | None |
| A0A7J7INZ5 | 12-181 | None |
| A0A0N0RSA2 | 30-220 | None |
| A0A4Y9ZEA0 | 10-148 | None |
| A0A367KE43 | 31-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.