DPCstruct | MC4245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 125 ± 12 aa |
| Standard deviation of domain lengths | 12.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N6YDG2 | 1-114 | MHYQTTVRTDADYADIPKAAAFIIDRESAQSILRLSALIKANGLHCLELFDYRVDWDWGDAEGSTEAETLVVFAEEFCFSAMVKHTN… |
| A0A845GH01 | 3-125 | NCKNYRVETRGGGDCHNTPRVAVFGIDEQTAREIVRLSALVAANDLHRIEKFDYRAQFLQFDPETDGEDAEDLGEENDVRTESDVLV… |
| A0A5C7UAJ2 | 106-220 | None |
| A0A7W6Z715 | 187-316 | None |
| A0A522RZI1 | 19-136 | None |
| A0A5F1BVV4 | 16-140 | None |
| A0A6C1NRQ6 | 5-132 | None |
| D3SGC5 | 2-104 | None |
| A0A1N6XD73 | 1-118 | None |
| A0A839D3P6 | 26-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.