DPCstruct | MC42445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 6.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V3NC65 | 1-63 | MVELKLSDNPNIALDLWKLIHMTRQNGLYRYSVGAHIILDLKRQTVAQSIIFVGGAPHPELTD |
| A0A5D4H808 | 116-177 | AVVEVKKSGNSRGVDLDVAKLCGLTAGGDYEYTVGLHLIIDCKNAAVAEVVAYRGGEVDDDL |
| A0A3P3FUV7 | 34-100 | None |
| A0A529KYE4 | 75-136 | None |
| A0A7Y3NS65 | 133-197 | None |
| A0A8A7B3Y7 | 53-114 | None |
| C6HWW6 | 166-223 | None |
| A0A410QH52 | 582-637 | None |
| A0A443FTT6 | 1-75 | None |
| A0A0M6Z2G0 | 3-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.