DPCstruct | MC42440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 63 ± 3 aa |
| Standard deviation of domain lengths | 3.06 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 61.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452UCT2 | 116-176 | LLRLLIPERFNETIGLQHMKVYLFDNNVILSGANLSDSYFTNRQDRYVFLQDCAEIADFFT |
| A0A2Y9QNB0 | 94-154 | LLRLLMPERFNETIGLQHIKVYLFDNNVILSGANLSDSYFTNRQDRYVFLQDCPEVADFFS |
| A0A7R8CBR1 | 437-499 | None |
| A0A834M2X8 | 164-223 | None |
| A0A3P7LG57 | 88-157 | None |
| A0A0N4XBD1 | 114-176 | None |
| A0A6I9XUS8 | 95-154 | None |
| A0A1Y2C091 | 90-155 | None |
| A0A183IQ16 | 130-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.