DPCstruct | MC42437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 102 ± 21 aa |
| Standard deviation of domain lengths | 21.46 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354CXF2 | 13-108 | SLLGLVMGSAWGAEGDVVFKREDVERDTAPAVFPHWSHRIRYRCYVCHPALFKMQANADRITMDDILAGKFCGACHDGKTAWPVTFE… |
| A0A7C2PPY8 | 29-109 | EIVYTKPVKGVQFSHKLHVKELGLPCESCHTAIFEMEAFKSQRNPDFNMESLYRGKYCGACHNGQTAFASNTKCATCHVGV |
| A0A2N6F3S9 | 151-303 | None |
| A0A7C1G5W8 | 68-164 | None |
| A0A522WA42 | 148-288 | None |
| A0A353V2R5 | 45-149 | None |
| A0A7V1MKR9 | 9-109 | None |
| A0A7C3L711 | 93-186 | None |
| A0A831XDJ5 | 19-100 | None |
| A0A7Y7TGL0 | 182-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.