DPCstruct | MC42436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 104 ± 15 aa |
| Standard deviation of domain lengths | 14.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.90 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0179- PF14319 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353RZ79 | 6-112 | HISKVTFKQIFIDHWESFKQNCHLYDTVYYDSVINKMINCGDPEKMGYAKYRCIYCGSSYTISMTCKSCFCLSCSVPYADRWIDFIG… |
| A0A080M2Y8 | 1-70 | MGAIQEIFRRHGPAYLAEFGKTLPGSHARVIEAIIDCRSAACGSVFYQCEDCGEPHVAARCCGNRHCPVC |
| A0A7X1P9G5 | 8-112 | None |
| A0A3D6C8N0 | 10-79 | None |
| A0A136LJB9 | 7-112 | None |
| A0A1H4GHX2 | 4-104 | None |
| A0A377HGR2 | 71-172 | None |
| A0A084Y5N2 | 10-129 | None |
| A0A533QIU0 | 3-103 | None |
| A0A376E240 | 9-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.