DPCstruct | MC42435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 138 ± 19 aa |
| Standard deviation of domain lengths | 18.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0LQD8 | 113-209 | ASMDRAEAEAMLAKPLDIRGARIVFDGKACEGIRFSRTKEKLSAYLERVYKIGPKDLELTDQLIEVIRTDCGLPGFQEYMRLGDRRL… |
| A0A0Q7X6U9 | 4-121 | AIFGTWKITQVADGQDSTSISDEEAAATVGLPLQIGPDTIRFGKANCAAPVFRTTRRRTYTYFVRQFNFDPQSLHLPDSVLEIEVKC… |
| A0A2A4G5N2 | 27-151 | None |
| A0A2V8SQ60 | 148-258 | None |
| A0A2E6KJX5 | 38-160 | None |
| A0A3E1S3E2 | 25-152 | None |
| A0A5R9PHM3 | 55-197 | None |
| A0A5F1UJ11 | 12-164 | None |
| A0A7U9R7M4 | 356-511 | None |
| A0A399RSQ2 | 21-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.