DPCstruct | MC42432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 244 ± 33 aa |
| Standard deviation of domain lengths | 32.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673WCY8 | 62-301 | SDESSHDSLEEIEDISDSGSDFEVQLKAMKRRKQTTALLGPRPPKRPRHKAASQASPNPSTTSTPPARSPQPPQPSLGRTRQLGSPR… |
| A0A1M8ABR5 | 20-279 | SDTEEEEVDTPPLPTKRGRQTTTFDSDSSLSDLSEEEAPQPAPKRSRTRKTVEYAPDVSETSDSELFQAVLAAEGLDEAAENWVMAF… |
| A0A3F2RMX4 | 24-229 | None |
| A0A817NDV1 | 27-256 | None |
| D7G0R2 | 94-367 | None |
| A0A6I9MVJ9 | 7-230 | None |
| U9SVZ2 | 316-525 | None |
| A0A2G9SCG1 | 54-288 | None |
| A0A3Q3W8Y8 | 1-186 | None |
| A0A5N4CXP3 | 3-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.