DPCstruct | MC42430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 99 ± 17 aa |
| Standard deviation of domain lengths | 16.90 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 66.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06305 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A221QAK0 | 2-89 | RKEPPRGTRAGVIWTFTVGAVLLLILLIIFMIQNQDRVTVYFLGFHGQLALGITLLIAAVGGALVVSIVGAVRIIQLRARAHSASKSL |
| A0A5M9RKK7 | 89-177 | HKAEKVQGSLAASTWVGLIVGFLLLILLIVFIMQNQQQVPMNFLKWSGEFPAGVAYLIFAVAGALLMALVGGLRMLELRRQVRKQAK… |
| A0A1E4I1N4 | 1-127 | None |
| A0A428X8K1 | 37-124 | None |
| A0A0Q7KRE8 | 2-72 | None |
| A0A838LLC6 | 11-100 | None |
| A0A4R4LJQ5 | 2-75 | None |
| A0A4R4WY90 | 117-227 | None |
| A0A2W6AR32 | 1-118 | None |
| I8QUN1 | 90-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.