DPCstruct | MC42429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 127 ± 16 aa |
| Standard deviation of domain lengths | 16.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19555 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1K1M2Y2 | 28-165 | DFDFSKVPSWYILCTNKDCPLKDNCLRFKAGSHAPDNLEYANCIMPKTLKDGKCRWFDKITIAVWAAGFTHLYDRVMKDDYTEMRKA… |
| R6YP97 | 6-136 | NFGAVCPMASCKRNAQCVRYANYLKAKNEEDSYQVLNFDRISYDADKGCSHFLVWEKQRWAKGFRRMFRTMPVCNTHYFWTRTPYLS… |
| A0A413CBG1 | 7-136 | None |
| E5UXL2 | 1-95 | None |
| A0A1G8I2X5 | 8-113 | None |
| R6X928 | 14-147 | None |
| C3QBV4 | 45-180 | None |
| D0TGQ3 | 1-144 | None |
| R5SUR8 | 6-145 | None |
| C9Q0I1 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.