DPCstruct | MC42422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 212 ± 30 aa |
| Standard deviation of domain lengths | 30.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19877 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538AAC1 | 3-228 | RARAVVFGGWRMLLAGLALSFVGLLVLAAVKPGARPIAYNIPTSSGSDAVGGTVFTVLTVPNRAALALFPSMGSCLGVFANVQGADV… |
| A0A1D2QE19 | 6-170 | LASFCTRGFTFGLLSYLVGYLLVAALFVVGPANVKGPLDVKLKWFGFAFYNAHFIPIAIGSQSYNYISQASDPAVPPIVYYAIPVVS… |
| T0CY68 | 18-195 | None |
| A0A4V1FX92 | 27-223 | None |
| A0A2M9KZI2 | 57-251 | None |
| A0A087C117 | 63-305 | None |
| A0A6J6ACV8 | 1-176 | None |
| A0A401ZUW7 | 395-625 | None |
| A0A150KZL3 | 18-255 | None |
| A0A6G2BF06 | 226-444 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.