DPCstruct | MC4241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 243 ± 33 aa |
| Standard deviation of domain lengths | 32.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1A5J2 | 5-253 | DKPVKATERRTVLGSPLISVLLAAGIGTAAFGLLALLGWVLGWPLLTSFGADLIPMAPSTAVLFLLNGVAVSLRARTPLSGRAFRFS… |
| A0A0D1D4B0 | 2-202 | KTLVQIRTLVLVFGLAALLFSVGSLVFGWHLDVQALVRFRPGQPAMVPSTALCIALLAAAVVIGPGFGQARMAKRLAVVAVVVALGN… |
| A0A1H2EMD8 | 1-262 | None |
| A0A0S9N4W8 | 10-212 | None |
| S7WW07 | 1-325 | None |
| A0A1G0ZSD2 | 47-266 | None |
| A0A838JR63 | 2-190 | None |
| A0A426CPA5 | 1-247 | None |
| A0A7C5UXA5 | 13-322 | None |
| A0A6S6LVJ5 | 4-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.