DPCstruct | MC42405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 327 ± 29 aa |
| Standard deviation of domain lengths | 28.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U1ALM7 | 1-291 | MQEYFEYEDLHKHQGTENYEVVIIYNENSIIKEKLIEEKQHFLSVIGRDEKQKISERKKVDFFGNTINKFIIYNTLSDGTLWGSEHY… |
| A0A0F9NCR1 | 3-315 | FRKFWILIVISNLLFNVMCNLRKDYNSHQELHKHDGTKNYEVSSIFKKEFEILELYLDTVSKQLNIAGRTNPIYTDEIEGGRKKISA… |
| A0A250G1U3 | 1-370 | None |
| A0A0C1GL86 | 13-371 | None |
| A0A519NN20 | 1-275 | None |
| A0A2I2M6U7 | 1-327 | None |
| A0A7T9SA83 | 50-407 | None |
| A0A1T4R7W4 | 10-361 | None |
| A0A4Q5V9Z1 | 1-326 | None |
| A0A1K1MT13 | 35-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.