DPCstruct | MC424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 129 ± 13 aa |
| Standard deviation of domain lengths | 13.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A136PHQ3 | 102-233 | KIPDGIEISDTLASGNRYVVRIIKKKFHPKQHRITRDSVGWVTRIDGQTFWGTDGGLPRDEIKKIQVFINGRAIAIPNRAWKPYYEP… |
| A0A2V8RH90 | 17-138 | FRFVQRKGKHVAEVMFETRKFEPKKHWITRNADCLVMVDGRVPLGTDCSMPVVEIASMRFYFDGKEVPVTKHLFTDCYNPDLADYPA… |
| A0A370DNM2 | 7-149 | None |
| A0A851GCQ5 | 35-171 | None |
| A0A7T9HV44 | 171-306 | None |
| A0A831UF84 | 2-101 | None |
| A0A7Y4QP06 | 13-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.