DPCstruct | MC42395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 63 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 75.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L9VK81 | 1-64 | MVKLGREVPVASMDNSGKIIWAKHNEIQTVNIKGVGADVEIADGERLPLAVKELGTCDLYPQVS |
| S7MRE4 | 3-51 | MDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGSCEIYPQ |
| A0A7J7N7A1 | 1-50 | None |
| A0A6S7MW95 | 18-78 | None |
| A0A6S7MNR6 | 98-158 | None |
| A0A6S7M8P5 | 43-103 | None |
| M4CH59 | 466-524 | None |
| A0A6A6LIS7 | 616-675 | None |
| A0A0L9V3Z1 | 210-272 | None |
| A0A5A7VKP7 | 57-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.