DPCstruct | MC42383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 11.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2Q5X2 | 1-110 | MPDAWRVYEDLIAEIPQDVVVGTVNVGVRGTRVVNSAGGGGMAWTMDQRSRPEIFEGAVLDGLPMRTAAGLVCSWNPAEASIGQASI… |
| A0A2D7JJE6 | 116-199 | RMVEELVQNTAADQVRDVVIGVHWTLVMTDHGCGLAQTPAKGTPGFRALNSGSGLRGRRLDHLAAWARTHNPLARAIGMAAINA |
| A0A1W9UYF1 | 3-97 | None |
| A0A0S7Z247 | 1-95 | None |
| A0A2N5YVD0 | 26-149 | None |
| A0A2M7Q3L2 | 10-95 | None |
| A0A375I4A6 | 1-106 | None |
| A0A3N5G7C0 | 85-184 | None |
| A0A1V6ACX0 | 4-106 | None |
| V4K9T6 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.