DPCstruct | MC42381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 277 ± 63 aa |
| Standard deviation of domain lengths | 62.53 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07907 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3CUQ1 | 14-299 | VFSVSPVTDFDPGDRVVMGYRPDVDPDFQYQFFDLQRRSVLAWVAVLFAAAVVLLGRLRGVAALAGLLASLGLLFWFVLPAILDGKP… |
| A0A844EDB1 | 4-167 | ASVIILILIVVIIIPVEYWAQVGGFGLEDSEELEGLSTYVGINFTKVAIATAILSSLGAVAEAAIAISSGLDEIVTQHKEITSSQLF… |
| A0A1W9VU44 | 3-194 | None |
| A0A7W7FUJ1 | 62-408 | None |
| A0A2H0NCW2 | 4-285 | None |
| A0A261CT94 | 48-419 | None |
| R6P6U8 | 46-382 | None |
| A0A369B2S8 | 5-182 | None |
| A0A0X1RW72 | 2-249 | None |
| A0A535R8X4 | 162-484 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.