DPCstruct | MC42380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 56 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 63.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3AA41 | 2-50 | DQFSYGVSDRGASIRIPWQVALDKKGYIEDRRPNANADPYILASLLTET |
| A0A016SJ02 | 37-86 | EKFTWGVANRAASVRIPRGVAIAGKGYLEDRRPSSNCDPYQVTRMIAESI |
| A0A0D9WAM5 | 1107-1160 | None |
| A0A820AMC1 | 112-162 | None |
| A0A3P6TL18 | 28-79 | None |
| A0A1E5RB26 | 42-88 | None |
| A0A6P4AX73 | 71-124 | None |
| A0A058ZSC8 | 11-64 | None |
| A0A5N5JBZ2 | 79-136 | None |
| A0A1D6PGP9 | 45-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.