DPCstruct | MC4237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 75 ± 2 aa |
| Standard deviation of domain lengths | 1.50 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 77.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3PWW5 | 1-77 | MKKCLVAILLFAALTFVATEANAQCAMCKAGAETSIQSGSSGAAGINKGILYLFFTPYIVGGVIGFFWWRNKKRAEA |
| A0A6S6S139 | 7-78 | KIVQLAGLVLVVILITSLMVEAQCPMCKMSAESNLKSGGTAAAGLNKGIIYLLIGPYIMMTVVGYLWWRNRR |
| A0A8A7WLK6 | 1-75 | None |
| A0A098LN05 | 1-74 | None |
| A0A4P5TM10 | 12-86 | None |
| A0A136N3J7 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.