DPCstruct | MC42368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 469 ± 46 aa |
| Standard deviation of domain lengths | 45.59 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 14.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7GEY9 | 2-504 | DYADLMRAKPDGYHSAAQALRRFGEDVRDRAVDYWNQVVQPLKDTSSSGIWGAAAEAAQVPMMDLQLALNRAADQIEAVPQILTRYA… |
| A0A5C7YP37 | 1-455 | MGELSMADVDQWQPDKIDEVADALAERARTGGQTAEDLRGLHDMATWEGDAGDAARQAIDKSATELEISAQNDTLASLFTKKSAGDV… |
| A0A1X1NLM2 | 35-500 | None |
| A0A7Z6XG61 | 8-487 | None |
| A0A100I307 | 2-394 | None |
| A0A1E7K5S2 | 2-408 | None |
| A0A2M9B7V0 | 2-396 | None |
| A0A7Y5TBQ4 | 94-669 | None |
| A0A7W0CJS7 | 1-494 | None |
| A0A1H4ZDK8 | 26-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.