DPCstruct | MC42365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Standard deviation of domain lengths | 14.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832EJT0 | 1-114 | MDKNRWLYLTGALLYVDFTALVILGLLLKFAIPTGPRAGGSPPSFLGVTRHSWADVHGTLGILFVALVVIHIALNWTWVVNSSKRYF… |
| D4IPJ8 | 1-114 | MKNRLRTNILIDAGLLVGMAAVSISGFVMNVILPSRHAIRHAGARAHASQLLGMGRHDWGTIHTWVGVALLLLLILHVAFHWKTIDA… |
| A0A832NHP0 | 1-95 | None |
| A0A1G0ZUW0 | 8-125 | None |
| A0A3L8C2N6 | 15-123 | None |
| A0A101IEM4 | 1-113 | None |
| A0A7V3K303 | 38-139 | None |
| A0A7C5X134 | 1-102 | None |
| A0A3E0P3C4 | 55-182 | None |
| A0A2V2BTV5 | 60-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.