DPCstruct | MC42364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Standard deviation of domain lengths | 21.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831ZKQ7 | 18-166 | RVKVQVDRPASRDAEVLPEDMDPKAVGAVQILSVLQRQGRLIDFLEEDLSRYEDAQIGAAVRSIHESCKAALAECVHLETVMAQEEG… |
| A0A2I3C1N1 | 3-120 | LLSIMQQEARLIDFLKEDLTSFSDEEVGAAARVIHTGGQKVLNDYVTLAHVRNEDEETRITVEEGFNPQEIRLTGNVTGSAPFNGTL… |
| A0A655VBF3 | 1-100 | None |
| A0A7W0M5E3 | 65-199 | None |
| A0A1E7IL22 | 49-211 | None |
| A0A212KVS4 | 25-162 | None |
| A0A661QML1 | 190-319 | None |
| A0A150P410 | 2-86 | None |
| A0A1Y6CFD8 | 113-268 | None |
| A0A517TXT9 | 31-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.