DPCstruct | MC42363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 350 ± 75 aa |
| Standard deviation of domain lengths | 75.14 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0416 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7FPA8 | 31-541 | KQVKALMERVYEFREQAARAKQEVASQQEENKELKMRIEQMREDHSEMMVAQARGGLTGGINRANARDSKNTRDREAEMRRRRLAKN… |
| A0A1S3PWD4 | 6-375 | SQSDEEGKEDEHADSNDPEQMFQNIQFQKEIIANIRTRAWPMRRKLKALKQAREIVLKYEGRLTRTRGYQAAGADLLKKVSRLLYNI… |
| A0A1B0C660 | 55-477 | None |
| A0A7R9A3K8 | 65-274 | None |
| A0A0N5CXV2 | 82-410 | None |
| A0A0N5DBZ4 | 4-217 | None |
| A0A2A3EJ41 | 81-352 | None |
| T1FAD0 | 131-547 | None |
| A0A643C531 | 3-390 | None |
| B2KIM1 | 2-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.